PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0053s0014.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GATA
Protein Properties Length: 181aa    MW: 19622.2 Da    PI: 10.6175
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0053s0014.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.44e-183670135
                 GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                         C+ Cgt+ TplWR gp g+k+LCnaCG++ rkk++
  Cagra.0053s0014.1.p 36 CVDCGTSRTPLWRGGPAGPKSLCNACGIKSRKKRQ 70
                         *********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.1893085IPR000679Zinc finger, GATA-type
SMARTSM004017.6E-113082IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.55E-123169No hitNo description
Gene3DG3DSA:3.30.50.109.5E-153470IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.06E-113569No hitNo description
PROSITE patternPS0034403661IPR000679Zinc finger, GATA-type
PfamPF003205.1E-163670IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MSEETKTKLE SAGDLSDVDN GNCSSSGSGG DTKKTCVDCG TSRTPLWRGG PAGPKSLCNA  60
CGIKSRKKRQ AALGIRQEDN KIKNKTSSNN LNLENRNVKI GKAEAGNVKN RIIKTDSESY  120
SNTNNNNNNS KKNVKRVSRF LDLGFKVPAM KRSAVEKKRL WRKLGEEERA AVLLMTLSCG  180
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1190211e-103AK119021.1 Arabidopsis thaliana At4g16141 mRNA for unknown protein, complete cds, clone: RAFL21-34-K14.
GenBankAK2280251e-103AK228025.1 Arabidopsis thaliana mRNA for hypothetical protein, partial sequence., clone: RAFL14-54-B16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284629.11e-101hypothetical protein CARUB_v10005860mg
SwissprotQ9LIB52e-69GAT17_ARATH; GATA transcription factor 17
TrEMBLR0F6T51e-101R0F6T5_9BRAS; Uncharacterized protein
STRINGAT4G16141.12e-77(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM138161624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16141.17e-80GATA family protein